PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008785-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 192aa    MW: 22133.8 Da    PI: 6.9392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008785-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.5e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+++++ +G + Wk++a + g++R++k+c++rw++yl
    NNU_008785-RA 15 RGAWTAEEDGKLAQYIEIHGAKKWKSVAVKAGLNRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.93.6e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    NNU_008785-RA  68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5811062IPR017930Myb domain
SMARTSM007178.7E-141464IPR001005SANT/Myb domain
SuperFamilySSF466896.24E-2914109IPR009057Homeodomain-like
PfamPF002495.3E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-241669IPR009057Homeodomain-like
CDDcd001671.58E-91762No hitNo description
PROSITE profilePS5129425.67263117IPR017930Myb domain
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PfamPF002491.5E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-2570118IPR009057Homeodomain-like
CDDcd001677.09E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAAKNDQPTK KLVNRGAWTA EEDGKLAQYI EIHGAKKWKS VAVKAGLNRC GKSCRLRWLN  60
YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKINQQ  120
KPKPCESSAE KHEPEPQKTW ENTEVSEESK KEGGESETGF NVDDFFDFSS EESFGLEWMN  180
TFLELDEGLY FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258843.11e-141PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI04e-54WER_ARATH; Transcription factor WER
TrEMBLA0A061GB733e-91A0A061GB73_THECC; Myb domain protein 5
STRINGPOPTR_0003s06320.12e-83(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.14e-53myb domain protein 66